Tesamorelin Description
Tesamorelin is a synthetic peptide analogue of GHRH with a trans-3-hexenoic acid moiety anchored at the N-terminus of its 44-amino acid sequence, providing enhanced stability compared to endogenous GHRH. The compound stimulates pituitary secretion of growth hormone and subsequently increases insulin-like growth factor-1 (IGF-1) and insulin-like growth factor binding protein-3 (IGFBP-3) levels in biological systems.
Tesamorelin Peptide Structure
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula: C223H370N72O69S
Molecular Weight: 5196 g/mol
PubChem CID: 44147413
CAS Number: 901758-09-6
Synonyms:
- Tesamorelin acetate
- 901758-09-6
- TH9507
- UNII-LGW5H38VE3
- Tesamorelin acetate [USAN]
Research Areas:
- Visceral Adipose Tissue Reduction
- Non-Alcoholic Fatty Liver Disease (NAFLD)
- Fat Quality
- Cardiovascular and Metabolic Health
- Neurocognitive Impairment
Source: PubChem
Lyophilized Peptides:
These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.
Product Usage:
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
