Tesamorelin and Ipamorelin Blend Description
The Tesamorelin/Ipamorelin blend combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.
This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).
Tesamorelin / Ipamorelin Peptide Structure
Tesamorelin
Sequence:Â YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula:Â C223H370N72O69S
Molecular Weight:Â 5196 g/mol
PubChem CID:Â 44147413
CAS Number:Â 901758-09-6
Synonyms:
- Tesamorelin acetate
- 901758-09-6
- TH9507
- UNII-LGW5H38VE3
- Tesamorelin acetate [USAN]
Ipamorelin
Sequence: Aib-His-D-2Nal-D-Phe-Lys
Molecular Formula: C38H49N9O5
Molecular Weight: 711.9 g/mol
PubChem CID: 9831659
CAS Number: 170851-70-4
Synonyms:
- 170851-70-4
- Ipamorelin [INN]
- NNC-26-0161
- UNII-Y9M3S784Z6
Lyophilized Peptides:
These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.






